NFE2L3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NFE2L3 antibody: synthetic peptide directed towards the middle region of human NFE2L3. Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	nuclear factor, erythroid 2 like 3
Database Link	NP_004280 Entrez Gene 9603 Human UniProt ID Q9Y4A8
Background	NFE2L3 activates erythroid-specific, globin gene expression.
Synonyms	NRF3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 92%; Pig: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.