BLBP (FABP7) Rabbit Polyclonal Antibody
CAT#: TA334290
Rabbit Polyclonal Anti-FABP7 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FABP7 antibody: synthetic peptide directed towards the N terminal of human FABP7. Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 15 kDa |
Gene Name | fatty acid binding protein 7 |
Database Link | |
Background | The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. |
Synonyms | B-FABP; BLBP; FABPB; LTR2-FABP7; MRG |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85% |
Reference Data | |
Protein Pathways | PPAR signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |