PDZD6 (INTU) Rabbit Polyclonal Antibody

CAT#: TA334312

Rabbit Polyclonal Anti-INTU Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of inturned planar cell polarity effector homolog (Drosophila) (INTU)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human inturned planar cell polarity effector homolog (Drosophila) (INTU), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human inturned planar cell polarity effector homolog (Drosophila) (INTU), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-INTU antibody is: synthetic peptide directed towards the C-terminal region of Human INTU. Synthetic peptide located within the following region: TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 104 kDa
Gene Name inturned planar cell polarity protein
Background INTU plays a key role in ciliogenesis and embryonic development. INTU is a regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. It plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension and has an indirect effect on hedgehog signaling.
Synonyms INT; PDZD6; PDZK6
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...