MTERF2 Rabbit Polyclonal Antibody
CAT#: TA334331
Rabbit Polyclonal Anti-MTERFD3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MTERFD3 antibody is: synthetic peptide directed towards the N-terminal region of Human MTERFD3. Synthetic peptide located within the following region: TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | mitochondrial transcription termination factor 2 |
Database Link | |
Background | MTERFD3 binds promoter DNA and regulates mitochondrial transcription. It is required for normal levels of transcription, both for mRNA and tRNA and is required for normal mitochondrial protein synthesis, assembly of respiratory complexes and normal mitochondrial function. |
Synonyms | MTERFD3; mTERFL |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 82% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |