SPINK9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPINK9 antibody is: synthetic peptide directed towards the middle region of Human SPINK9. Synthetic peptide located within the following region: KKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	9 kDa
Gene Name	serine peptidase inhibitor, Kazal type 9
Database Link	NP_001035523 Entrez Gene 643394 Human UniProt ID Q5DT21
Background	SPINK9 is a Serine protease inhibitor which specifically inhibits KLK5. It may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.
Synonyms	LEKTI2
Note	Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Dog: 92%; Rabbit: 92%; Rat: 90%; Pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.