DDAH1 Rabbit Polyclonal Antibody
CAT#: TA334438
Rabbit Polyclonal Anti-DDAH1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 2 publications. |
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDAH1 antibody: synthetic peptide directed towards the middle region of human DDAH1. Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | dimethylarginine dimethylaminohydrolase 1 |
Database Link | |
Background | DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Sequence Note: AB001915.1 is a chimeric sequence. Only the DDAH1 region was propagated into this RefSeq record. [6/17/03, RefSeq staff]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | DDAH; HEL-S-16 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
The iridoid loganic acid and anthocyanins from the cornelian cherry (Cornus mas L.) fruit increase the plasma l-arginine/ADMA ratio and decrease levels of ADMA in rabbits fed a high-cholesterol diet.
,null,
Phytomedicine : international journal of phytotherapy and phytopharmacology
,PubMed ID 30599888
[DDAH1]
|
The iridoid loganic acid and anthocyanins from the cornelian cherry (Cornus mas L.) fruit increase the plasma L-arginine/ADMA ratio and decrease levels of ADMA in rabbits fed a high-cholesterol diet
,Sozański, T;Kucharska, A;Wiśniewski, J;Fleszar, M;Rapak, A;Gomułkiewicz, A;Dzięgiel, P;Magdalan, J;Nowak, B;Szumny, D;Matuszewska, A;Piórecki, N;Szeląg, A;Trocha, M;,
Phytomedicine
[DDAH1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |