IFIT5 Rabbit Polyclonal Antibody
CAT#: TA334458
Rabbit Polyclonal Anti-IFIT5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
| Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the N terminal of human IFIT5. Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 56 kDa |
| Gene Name | interferon induced protein with tetratricopeptide repeats 5 |
| Database Link | |
| Background | IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown. |
| Synonyms | ISG58; P58; RI58 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 85% |
| Reference Data | |
Citations (1)
| The use of this Antibodies has been cited in the following citations: |
|---|
|
Quantitative Proteomic Analysis of Duck Ovarian Follicles Infected with Duck Tembusu Virus by Label-Free LC-MS
,null,
Frontiers in Microbiology
,PubMed ID 27066001
[IFIT5]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
