Carboxypeptidase B (CPB1) Rabbit Polyclonal Antibody

CAT#: TA334670

Rabbit Polyclonal Anti-CPB1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of carboxypeptidase B1 (tissue) (CPB1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name carboxypeptidase B1
Background The specific function of the protein remains unknown.Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.
Synonyms CPB; PASP; PCPB
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...