BRD8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BRD8 antibody: synthetic peptide directed towards the middle region of human BRD8. Synthetic peptide located within the following region: LRSQDLDEELGSTAAGEIVEADVAIGKGDETPLTNVKTEASPESMLSPSH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	135 kDa
Gene Name	bromodomain containing 8
Database Link	NP_631938 Entrez Gene 10902 Human UniProt ID Q9H0E9
Background	BRD8 interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator.The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified.
Synonyms	p120; SMAP; SMAP2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.