TMEM199 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM199 antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM199. Synthetic peptide located within the following region: KPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	transmembrane protein 199
Database Link	NP_689677 Entrez Gene 147007 Human UniProt ID Q8N511
Background	The function of this protein remains unknown.
Synonyms	C17orf32; CDG2P; VMA12; VPH2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%; Zebrafish: 81%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.