C19orf75 (SIGLECL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIGLECL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SIGLECL1. Synthetic peptide located within the following region: RKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRILEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	SIGLEC family like 1
Database Link	NP_775906 Entrez Gene 284369 Human UniProt ID Q8N7X8
Background	The function of this protein remains unknown.
Synonyms	C19orf75; SIGLEC23P; SIGLECP7
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.