ARMH1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf228 antibody is: synthetic peptide directed towards the N-terminal region of Human C1orf228. Synthetic peptide located within the following region: LSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	chromosome 1 open reading frame 228
Database Link	NP_001139108 Entrez Gene 339541 Human UniProt ID Q6PIY5
Background	The function of this protein remains unknown.
Synonyms	NCRNA00082; p40
Note	Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%; Dog: 77%; Mouse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.