CD200R1L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CD200R1L antibody is: synthetic peptide directed towards the N-terminal region of Human CD200R1L. Synthetic peptide located within the following region: ETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	CD200 receptor 1 like
Database Link	NP_001008784 Entrez Gene 344807 Human UniProt ID Q6Q8B3
Background	CD200R1L may be a receptor for the CD200/OX2 cell surface glycoprotein.
Synonyms	CD200R2; CD200RLa
Note	Immunogen Sequence Homology: Human: 100%; Rat: 83%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.