C8orf80 (NUGGC) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NUGGC antibody is: synthetic peptide directed towards the C-terminal region of Human NUGGC. Synthetic peptide located within the following region: RSGWKYDSCKKNFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	nuclear GTPase, germinal center associated
Database Link	NP_001010906 Entrez Gene 389643 Human UniProt ID Q68CJ6
Background	NUGGC plays a role as replication-related GTPase protein in germinal center B-cell.
Synonyms	C8orf80; HMFN0672; SLIP-GC
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.