ZYG11A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZYG11A antibody is synthetic peptide directed towards the C-terminal region of Human ZYG11A. Synthetic peptide located within the following region: PEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	85 kDa
Gene Name	zyg-11 family member A, cell cycle regulator
Database Link	NP_001004339 Entrez Gene 440590 Human UniProt ID Q6WRX3
Background	ZYG11A probably acts as target recruitment subunit in an E3 ubiquitin ligase complex ZYGA-CUL2-elongin BC.
Synonyms	ZYG11
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 92%; Rat: 85%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.