CENPP Rabbit Polyclonal Antibody

CAT#: TA334933

Rabbit Polyclonal Anti-CENPP Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of centromere protein P (CENPP)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human centromere protein P (CENPP), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human centromere protein P (CENPP), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CENPP antibody: synthetic peptide directed towards the N terminal of human CENPP. Synthetic peptide located within the following region: VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 33 kDa
Gene Name centromere protein P
Background CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1104 CR592049.1 1-1104 1105-1633 BC071726.1 622-1150 1634-1689 BX537851.1 972-1027 1690-3411 AK091247.1 839-2560 3412-3428 AL833701.1 3078-3094
Synonyms CENP-P
Note Immunogen Sequence Homology: Human: 100%; Horse: 77%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...