KLKBL4 (PRSS54) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRSS54 antibody: synthetic peptide directed towards the C terminal of human PRSS54. Synthetic peptide located within the following region: EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	protease, serine 54
Database Link	NP_001073961 Entrez Gene 221191 Human UniProt ID Q6PEW0
Background	PRSS54 is a secreted protein. PRSS54 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.
Synonyms	CT67; KLKBL4
Note	Immunogen Sequence Homology: Human: 100%; Horse: 90%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.