SOHLH1 Rabbit Polyclonal Antibody
CAT#: TA334998
Rabbit Polyclonal Anti-SOHLH1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SOHLH1 antibody: synthetic peptide directed towards the C terminal of human SOHLH1. Synthetic peptide located within the following region: PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | spermatogenesis and oogenesis specific basic helix-loop-helix 1 |
Database Link | |
Background | SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis. |
Synonyms | bA100C15.3; bHLHe80; C9orf157; NOHLH; SPATA27; TEB2 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 79%; Yeast: 75% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |