RHOB Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RHOB antibody: synthetic peptide directed towards the middle region of human RHOB. Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 22 kDa |
| Gene Name | ras homolog family member B |
| Database Link | |
| Background | RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.RHOB is also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. |
| Synonyms | ARH6; ARHB; MST081; MSTP081; RHOH6 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 79%; Zebrafish: 79%; Guinea pig: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
