PPM1J Rabbit Polyclonal Antibody

CAT#: TA335085

Rabbit Polyclonal Anti-PPM1J Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of protein phosphatase 1J (PP2C domain containing) (PPM1J)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human protein phosphatase 1J (PP2C domain containing) (PPM1J), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human protein phosphatase 1J (PP2C domain containing) (PPM1J), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PPM1J antibody: synthetic peptide directed towards the N terminal of human PPM1J. Synthetic peptide located within the following region: TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name protein phosphatase, Mg2+/Mn2+ dependent 1J
Background PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known. This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.
Synonyms PP2CZ; PP2Czeta; PPP2CZ
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%
Reference Data
Protein Families Phosphatase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...