CFHL2 (CFHR2) Rabbit Polyclonal Antibody
CAT#: TA335100
Rabbit Polyclonal Anti-CFHR2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CFHR2 antibody is: synthetic peptide directed towards the C-terminal region of Human CFHR2. Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | complement factor H related 2 |
Database Link | |
Background | CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism. |
Synonyms | CFHL2; FHR2; HFL3 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 82% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |