C22orf36 (LRRC75B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C22orf36 antibody: synthetic peptide directed towards the middle region of human C22orf36. Synthetic peptide located within the following region: WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	leucine rich repeat containing 75B
Database Link	NP_997527 Entrez Gene 388886 Human UniProt ID Q2VPJ9
Background	The function of C22orf36 remains unknown.
Synonyms	C22orf36; FAM211B
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.