Protein S (PROS1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	protein S (alpha)
Database Link	NP_000304 Entrez Gene 81750 Rat UniProt ID P07225
Background	Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.
Synonyms	PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Complement and coagulation cascades

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.