Twist (TWIST1) Rabbit Polyclonal Antibody
CAT#: TA335179
Rabbit Polyclonal Anti-TWIST1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TWIST1 antibody: synthetic peptide directed towards the C terminal of human TWIST1. Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | twist family bHLH transcription factor 1 |
Database Link | |
Background | Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. |
Synonyms | ACS3; bHLHa38; BPES2; BPES3; CRS; CRS1; CSO; SCS; TWIST |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Dog: 79%; Rabbit: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Overexpression of PEAK1 contributes to epithelial-mesenchymal transition and tumor metastasis in lung cancer through modulating ERK1/2 and JAK2 signaling
,Ding, C;Tang, W;Fan, X;Wang, X;Wu, H;Xu, H;Xu, W;Gao, W;Wu, G;,
Cell Death Dis
,PubMed ID 30038287
[TWIST1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |