LY6G6F Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C6orf21 antibody: synthetic peptide directed towards the middle region of human C6orf21. Synthetic peptide located within the following region: LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	lymphocyte antigen 6 complex, locus G6F
Database Link	NP_001003693 Entrez Gene 259215 Human UniProt ID Q5SQ64
Background	The human G6f protein(C6orf21) is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition.It may also play a role in the downstream signal transduction pathways involving GRB2 and GRB7.The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de Vet et al., 2003 [PubMed 12852788]). [supplied by OMIM]
Synonyms	C6orf21; G6f; LY6G6D; NG32
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Horse: 92%; Bovine: 86%; Dog: 85%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.