DENND10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM45A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM45A. Synthetic peptide located within the following region: GQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	family with sequence similarity 45 member A
Database Link	NP_996892 Entrez Gene 404636 Human UniProt ID Q8TCE6
Background	The function of this protein remains unknown.
Synonyms	family with sequence similarity 45; fc44d12; fd19e06; member A; si:ch211-117n7.2; wu:fc44d12; wu:fd19e06
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.