FHL2 Rabbit Polyclonal Antibody
CNY 4537.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FHL2 Antibody: synthetic peptide directed towards the C terminal of human FHL2. Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | four and a half LIM domains 2 |
Database Link | |
Background | FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain. |
Synonyms | AAG11; DRAL; FHL-2; SLIM-3; SLIM3 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 87% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |