DNAJC18 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DNAJC18 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJC18. Synthetic peptide located within the following region: EWTQTRQGEGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	DnaJ heat shock protein family (Hsp40) member C18
Database Link	NP_689899 Entrez Gene 202052 Human UniProt ID Q9H819
Background	The function of this protein remains unknown.
Synonyms	MGC29463
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Goat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.