Chodl Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Chodl Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	chondrolectin
Database Link	NP_624360 Entrez Gene 246048 Mouse UniProt ID Q9CXM0
Background	Chodl is a single-pass type I membrane protein. The function of Chodl remians unknown.
Synonyms	C21orf68; chondrolectin; FLJ12627; MT75; PRED12
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.