Chodl Rabbit Polyclonal Antibody
CAT#: TA335399
Rabbit Polyclonal Anti-Chodl Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Chodl Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 30 kDa |
Gene Name | chondrolectin |
Database Link | |
Background | Chodl is a single-pass type I membrane protein. The function of Chodl remians unknown. |
Synonyms | C21orf68; chondrolectin; FLJ12627; MT75; PRED12 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 86%; Rabbit: 86%; Horse: 79%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |