FAM83D Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM83D Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM83D. Synthetic peptide located within the following region: HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	family with sequence similarity 83 member D
Database Link	NP_112181 Entrez Gene 81610 Human UniProt ID Q9H4H8
Background	FAM83D is required for proper chromosome congression and alignment during mitosis and is required for targeting KIF22/KID to the spindle microtubules.
Synonyms	C20orf129; CHICA; dJ616B8.3
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Horse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.