DHRS12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DHRS12 Antibody is: synthetic peptide directed towards the middle region of Human DHRS12. Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	dehydrogenase/reductase 12
Database Link	NP_078981 Entrez Gene 79758 Human UniProt ID A0PJE2
Background	This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms.
Synonyms	SDR40C1
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.