DENND2A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DENND2A Antibody is: synthetic peptide directed towards the N-terminal region of Human DENND2A. Synthetic peptide located within the following region: DRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	113 kDa
Gene Name	DENN domain containing 2A
Database Link	NP_056504 Entrez Gene 27147 Human UniProt ID Q9ULE3
Background	DENND2A is a guanine nucleotide exchange factor (GEF) which may activate RAB9A and RAB9B. It promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form and may play a role in late endosomes back to trans-Golgi network/TGN transport.
Synonyms	FAM31D; KIAA1277
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 91%; Dog: 86%; Pig: 86%; Mouse: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.