CRELD1 Rabbit Polyclonal Antibody
CAT#: TA335591
Rabbit Polyclonal Anti-Creld1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Creld1 Antibody is: synthetic peptide directed towards the middle region of Mouse Creld1. Synthetic peptide located within the following region: ACGQCGLGYFEAERNSSHLVCSACFGPCARCTGPEESHCLQCKKGWALHH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | cysteine rich with EGF like domains 1 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | AVSD2; CIRRIN |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |