BTBD3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-BTBD3 Antibody: synthetic peptide directed towards the N terminal of human BTBD3. Synthetic peptide located within the following region: VDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANTSSSSSNSSKLPPVCYE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	BTB domain containing 3
Database Link	NP_055777 Entrez Gene 22903 Human UniProt ID Q9Y2F9
Background	The exact function of BTBD3 remains unknown.
Synonyms	dJ742J24.1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.