PDHA2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	pyruvate dehydrogenase (lipoamide) alpha 2
Database Link	NP_005381 Entrez Gene 5161 Human UniProt ID P29803
Background	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Synonyms	PDHAL
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Rat: 86%; Horse: 85%; Dog: 79%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79%
Reference Data
Protein Pathways	Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.