SFRS17A (AKAP17A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DXYS155E Antibody: synthetic peptide directed towards the N terminal of human DXYS155E. Synthetic peptide located within the following region: NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	A-kinase anchoring protein 17A
Database Link	NP_005079 Entrez Gene 8227 Human UniProt ID Q02040
Background	DXYS155E is a gene found in the pseudoautosomal region of the distal short arms of the X and Y chromosomes, and appears to be ubiquitously expressed.
Synonyms	721P; AKAP-17A; CCDC133; CXYorf3; DXYS155E; PRKA17A; SFRS17A; XE7; XE7Y
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.