CTNS Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ctns Antibody is: synthetic peptide directed towards the middle region of Mouse Ctns. Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Database Link	NP_004928 Entrez Gene 83429 Mouse
Background	Ctns is thought to transport cystine out of lysosomes.
Synonyms	CTNS-LSB; PQLC4
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Rat: 92%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.