DNALI1 Rabbit Polyclonal Antibody

CAT#: TA335773

Rabbit Polyclonal Anti-DNALI1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of dynein, axonemal, light intermediate chain 1 (DNALI1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human dynein, axonemal, light intermediate chain 1 (DNALI1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human dynein, axonemal, light intermediate chain 1 (DNALI1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IF, WB
Recommend Dilution WB, IF
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-DNALI1 Antibody: synthetic peptide directed towards the N terminal of human DNALI1. Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 31 kDa
Gene Name dynein axonemal light intermediate chain 1
Background DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.
Synonyms dJ423B22.5; hp28; P28
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Pathways Huntington's disease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...