PRSS56 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PRSS56 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRSS56. Synthetic peptide located within the following region: PLSFLRLSCRSTRSAPNELLWTVTLAEGSRGEQAEEVPVNRILPHPKFDP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	protease, serine 56
Database Link	NP_001182058 Entrez Gene 646960 Human UniProt ID P0CW18
Background	This gene encodes a protein that contains a peptidase S1 domain and possesses trypsin-like serine protease activity. The encoded protein may play a role in eye development, and mutations in this gene are a cause of autosomal recessive posterior microphthalmos.
Synonyms	MCOP6
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 85%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.