CLCC1 Rabbit Polyclonal Antibody
CAT#: TA335946
Rabbit Polyclonal Anti-CLCC1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 61 kDa |
| Gene Name | chloride channel CLIC like 1 |
| Database Link | |
| Background | CLCC1 seems to act as a chloride ion channel. |
| Synonyms | MCLC |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Families | Ion Channels: Other, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
