l Afadin (AFDN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MLLT4 Antibody: synthetic peptide directed towards the N terminal of human MLLT4. Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4
Database Link	NP_001035089 Entrez Gene 4301 Human UniProt ID P55196
Background	AF6 is a Ras target that regulates cell-cell adhesions downstream of Ras activation. It is fused with MLL in leukemias caused by t(6;11) translocations.
Synonyms	AF6
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Yeast: 92%; Guinea pig: 92%; Zebrafish: 91%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Adherens junction, Leukocyte transendothelial migration, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.