PDE4 (PDE4B) Rabbit Polyclonal Antibody

CAT#: TA336008

Rabbit Polyclonal Anti-PDE4B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant b
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 64 kDa
Gene Name phosphodiesterase 4B
Background The specific function of this protein remains unknown.This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms DPDE4; PDEIVB
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Mouse: 86%; Guinea pig: 83%
Reference Data
Protein Families Druggable Genome
Protein Pathways Progesterone-mediated oocyte maturation, Purine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...