PDE4 (PDE4B) Rabbit Polyclonal Antibody
CAT#: TA336008
Rabbit Polyclonal Anti-PDE4B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 64 kDa |
Gene Name | phosphodiesterase 4B |
Database Link | |
Background | The specific function of this protein remains unknown.This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Synonyms | DPDE4; PDEIVB |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Mouse: 86%; Guinea pig: 83% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |