AGBL5 Rabbit Polyclonal Antibody
CAT#: TA336018
Rabbit Polyclonal Anti-AGBL5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AGBL5 Antibody: synthetic peptide directed towards the C terminal of human AGBL5. Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | ATP/GTP binding protein-like 5 |
Database Link | |
Background | AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown. |
Synonyms | CCP5; RP75 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 85%; Guinea pig: 85%; Mouse: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |