CCDC90A (MCUR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC90A Antibody: synthetic peptide directed towards the middle region of human CCDC90A. Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	mitochondrial calcium uniporter regulator 1
Database Link	NP_001026883 Entrez Gene 63933 Human UniProt ID Q96AQ8
Background	Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Synonyms	C6orf79; CCDC90A; FMP32
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.