S100P binding protein (S100PBP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-S100PBP Antibody: synthetic peptide directed towards the middle region of human S100PBP. Synthetic peptide located within the following region: ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	S100P binding protein
Database Link	NP_001017406 Entrez Gene 64766 Human UniProt ID Q96BU1
Background	The specific function of this protein remains unknown.
Synonyms	DKFZp313K2325; FLJ12903; S100PBPR
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.