SRD5A2L2 (TECRL) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tecrl Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tecrl. Synthetic peptide located within the following region: AGPLKTTTAVKHSKTTHFEIEILDAHTRKQICIVDKVTQTSTIHDVKQKF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	trans-2,3-enoyl-CoA reductase-like
Database Link	NP_001010874 Entrez Gene 243078 Mouse UniProt ID Q5HYJ1
Background	The function of this protein remains unknown.
Synonyms	GPSN2L; SRD5A2L2; TERL
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Bovine: 92%; Horse: 85%; Rabbit: 85%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.