Hexokinase II (HK2) Rabbit Polyclonal Antibody

CAT#: TA336241

Rabbit Polyclonal Anti-HK2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of hexokinase 2 (HK2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human hexokinase 2 (HK2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human hexokinase 2 (HK2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 102 kDa
Gene Name hexokinase 2
Background Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
Synonyms HKII; HXK2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 92%; Bovine: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Starch and sucrose metabolism, Type II diabetes mellitus
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...