RIN3 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RIN3 antibody: synthetic peptide directed towards the N terminal of human RIN3. Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 108 kDa |
Gene Name | Ras and Rab interactor 3 |
Database Link | |
Background | RIN3, biochemically characterized as the stimulator and stabilizer for GTP-Rab5, plays an important role in the transport pathway from plasma membrane to early endosomes. |
Synonyms | DKFZp762H1613; FLJ11700; FLJ22439 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Horse: 92%; Rat: 90%; Mouse: 79%; Dog: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |