LAS1L Rabbit Polyclonal Antibody
CAT#: TA337260
Rabbit Polyclonal Anti-LAS1L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-LAS1L antibody is: synthetic peptide directed towards the middle region of Human LAS1L. Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 83 kDa |
| Gene Name | LAS1-like, ribosome biogenesis factor |
| Database Link | |
| Background | The function of LAS1L has not been determined. |
| Synonyms | dJ475B7.2; Las1-like; WTS |
| Note | Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
