PSIP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the middle region of human PSIP1. Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	PC4 and SFRS1 interacting protein 1
Database Link	NP_150091 Entrez Gene 11168 Human UniProt ID O75475
Background	PSIP1 is a transcriptional coactivator. It also acts as an adaptor to coordinate pre-mRNA splicing and transcriptional activation of class II genes.
Synonyms	DFS70; LEDGF; p52; p75; PAIP; PSIP2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Stem cell - Pluripotency, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.